BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302F10f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 6.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 6.2 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.0 bits (47), Expect = 6.2 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +1 Query: 340 SK*TSPLNSPRNQPKNQRTVIGKRLKISNLKFINLNLNRTTSNLKYISRLSS 495 S+ T P N Q+ + RLK SNLK + R T N K L++ Sbjct: 64 SEETQPPNDAGRDRLQQQLLQKSRLKSSNLK--STTYTRNTENDKLTRHLNT 113 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 432 LEVGYFQPLPDYCSL 388 +E+G+ P PD CSL Sbjct: 1049 IEIGHKLPQPDICSL 1063 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 332,646 Number of Sequences: 2352 Number of extensions: 5597 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -