BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302F09f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0466 + 9599389-9599662,9600324-9600643,9600950-9601186,960... 30 1.3 05_04_0029 - 17321378-17321905,17323348-17323525,17323531-173239... 29 3.0 09_02_0317 + 7186148-7186243,7186406-7186572,7186766-7186878,718... 28 4.0 04_04_0534 + 26071227-26071811 28 4.0 04_04_0351 + 24615858-24616448 27 6.9 11_04_0225 + 15087975-15088123,15088908-15089154 27 9.1 03_01_0320 - 2510907-2512190 27 9.1 >09_02_0466 + 9599389-9599662,9600324-9600643,9600950-9601186, 9601278-9601445,9601778-9601966 Length = 395 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 265 LRSVLREDIDALVKHVYIVKR-KFAGAPVASLLVDRHVVIAVDHS 396 L +L+ I+ + KHV ++ R K G P + LL H +++ H+ Sbjct: 244 LELLLQSGIELMGKHVTVIGRSKVVGLPTSLLLQRHHATVSIIHA 288 >05_04_0029 - 17321378-17321905,17323348-17323525,17323531-17323910, 17323936-17324052 Length = 400 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -3 Query: 393 VVNCYDYMAIH-KKGGYGCTGELPFNYVNVFNQCINVFAQYRS 268 +V C Y+ I+ +GG GC + V C+NV Y S Sbjct: 350 LVPCLSYLKIYMSRGGVGCFERTMIVGILVIGVCVNVVGTYTS 392 >09_02_0317 + 7186148-7186243,7186406-7186572,7186766-7186878, 7187059-7187133,7187215-7187328,7187545-7187612, 7187690-7187773,7187966-7188019,7188104-7188184, 7188279-7188372,7188501-7188574,7188656-7188766, 7188976-7189032,7189119-7189223,7189584-7189687, 7190021-7190186,7190279-7190416 Length = 566 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 480 SSCTVDPYCAAQTVQNYMRRFGQ 412 S+ T+DP CA VQ + FGQ Sbjct: 43 STTTIDPTCANMVVQEFPNTFGQ 65 >04_04_0534 + 26071227-26071811 Length = 194 Score = 28.3 bits (60), Expect = 4.0 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -1 Query: 476 AAL*TRTAPRRPSKTT*EDLARTATATEWSTAMTTWRSTRREATGAPA 333 A L TR RRP++ + R A W +TTWR T + G P+ Sbjct: 90 ARLATRRRGRRPARRRRDCAWRRPAAWRW---LTTWRRTASKPDGYPS 134 >04_04_0351 + 24615858-24616448 Length = 196 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -3 Query: 447 QTVQNYMRRFGQ-DCNGDGVVNCYDYMAIHKKGGYGCTG 334 +T + R GQ D +GDG V+ ++++ + + GG+ G Sbjct: 158 RTAEECRRMIGQVDRDGDGRVDFHEFLQMMRGGGFAALG 196 >11_04_0225 + 15087975-15088123,15088908-15089154 Length = 131 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 5/32 (15%) Frame = +3 Query: 396 RRRCSPGQIF-----SCSFGRSARRSTGLQCS 476 RRRC P +F S FGR+A RS+G C+ Sbjct: 43 RRRCRPSMLFSPFSRSLGFGRNA-RSSGFGCT 73 >03_01_0320 - 2510907-2512190 Length = 427 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 402 GDGVVNCYDYMAIHKKGGYGCTGEL 328 GDGVV YD ++ K+G C E+ Sbjct: 364 GDGVVRVYDLPSLKKRGDIICDDEV 388 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,932,653 Number of Sequences: 37544 Number of extensions: 252649 Number of successful extensions: 580 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -