BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302F09f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 5.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.7 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 49 Y*ITFSNLYFEYTKNPLMKMLLYEHYLFQF*MNCRDS 159 Y +T YF T NP++ ++ Y F CR S Sbjct: 298 YPLTGCLYYFSTTINPILYNVMSAKYRNAFKETCRCS 334 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 7.7 Identities = 17/56 (30%), Positives = 22/56 (39%) Frame = -1 Query: 497 TLRMPTLAAL*TRTAPRRPSKTT*EDLARTATATEWSTAMTTWRSTRREATGAPAN 330 T +P +A T T P PS A A T +T T RR+ G A+ Sbjct: 225 TTTLPAASA--TGTGPATPSAVVATSNATAAMTTGTTTIPTRRLRKRRQNDGEGAD 278 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,467 Number of Sequences: 438 Number of extensions: 3183 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -