BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302F05f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92811-2|CAI46583.1| 299|Caenorhabditis elegans Hypothetical pr... 114 3e-26 U64598-12|AAX88835.1| 408|Caenorhabditis elegans Choline kinase... 32 0.22 U64598-11|AAK39220.1| 429|Caenorhabditis elegans Choline kinase... 32 0.22 Z81028-3|CAB02691.1| 545|Caenorhabditis elegans Hypothetical pr... 28 4.7 U28730-3|AAO38622.1| 243|Caenorhabditis elegans Hypothetical pr... 27 8.1 >Z92811-2|CAI46583.1| 299|Caenorhabditis elegans Hypothetical protein T01G1.4 protein. Length = 299 Score = 114 bits (275), Expect = 3e-26 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 1/98 (1%) Frame = +1 Query: 16 FFQLFCIKVIKTGRVPQHIAFIMDGNRRYAK-KNSVDKSTGHHKGFDKLSETLKWCLDLG 192 ++Q + I +G +P+H+AF+MDGNRR+AK K+ + GH KGF +L++ L WC G Sbjct: 22 WWQWLLRRFIASGPIPRHVAFVMDGNRRFAKTKHLGNVIKGHEKGFTQLAKILDWCNRFG 81 Query: 193 IPEVTVYAFSIENFKRSKEEVDALMELAREKFQNLLDE 306 I E+TVYAFSIENFKRS+EEV LM LA EKFQ LL++ Sbjct: 82 IREITVYAFSIENFKRSEEEVSGLMRLAEEKFQKLLND 119 >U64598-12|AAX88835.1| 408|Caenorhabditis elegans Choline kinase a protein 2, isoformb protein. Length = 408 Score = 32.3 bits (70), Expect = 0.22 Identities = 12/50 (24%), Positives = 25/50 (50%) Frame = +1 Query: 136 HHKGFDKLSETLKWCLDLGIPEVTVYAFSIENFKRSKEEVDALMELAREK 285 +++ FD + ++W +D I E Y ENF + + ++ + RE+ Sbjct: 287 NYRAFDFANHFIEWTIDYDIDEAPFYKIQTENFPENDQMLEFFLNYLREQ 336 >U64598-11|AAK39220.1| 429|Caenorhabditis elegans Choline kinase a protein 2, isoforma protein. Length = 429 Score = 32.3 bits (70), Expect = 0.22 Identities = 12/50 (24%), Positives = 25/50 (50%) Frame = +1 Query: 136 HHKGFDKLSETLKWCLDLGIPEVTVYAFSIENFKRSKEEVDALMELAREK 285 +++ FD + ++W +D I E Y ENF + + ++ + RE+ Sbjct: 308 NYRAFDFANHFIEWTIDYDIDEAPFYKIQTENFPENDQMLEFFLNYLREQ 357 >Z81028-3|CAB02691.1| 545|Caenorhabditis elegans Hypothetical protein B0365.6 protein. Length = 545 Score = 27.9 bits (59), Expect = 4.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 439 DLITFQYNNGTYYPSLTS 386 D +FQYN YYPSL++ Sbjct: 159 DTCSFQYNGNCYYPSLSA 176 >U28730-3|AAO38622.1| 243|Caenorhabditis elegans Hypothetical protein K10B2.3b protein. Length = 243 Score = 27.1 bits (57), Expect = 8.1 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 3 KLCIIFPTILYQSNKDRP--STPTHSIHNGWKQ 95 K+C+ F ++L+Q K R P + NGW Q Sbjct: 167 KMCVYFASVLFQRKKFRNWLIKPYSPLVNGWSQ 199 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,293,102 Number of Sequences: 27780 Number of extensions: 218839 Number of successful extensions: 725 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -