BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302F04f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4541| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_53736| Best HMM Match : Borrelia_orfA (HMM E-Value=0.64) 32 0.25 >SB_4541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 55.6 bits (128), Expect = 2e-08 Identities = 27/61 (44%), Positives = 38/61 (62%) Frame = +1 Query: 220 KMEAAXEDEYFYKKQKEQLANLXGHLNKEIAFHQEQIKRXEDAIRRHXEQMSDXEKPX*T 399 KME A E++YF + Q +QLA L H IA H+++I+ E+AIRRH E + EK + Sbjct: 82 KMEQAHEEQYFRQMQAQQLAALKEHQEHLIATHKQEIEHHEEAIRRHKEALKSYEKKDGS 141 Query: 400 G 402 G Sbjct: 142 G 142 >SB_53736| Best HMM Match : Borrelia_orfA (HMM E-Value=0.64) Length = 520 Score = 32.3 bits (70), Expect = 0.25 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +1 Query: 220 KMEAAXEDEYFYKKQKEQLANLXGHLNKEIAFHQEQIKRXEDAIR 354 K A E E K+Q ++L + G L E+A + IK+ ++AIR Sbjct: 349 KRRLAAETEEALKEQDDRLGKILGKLQLEVARRDDIIKKQDEAIR 393 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,651,529 Number of Sequences: 59808 Number of extensions: 151245 Number of successful extensions: 414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -