BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302F02f (470 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces p... 27 1.1 SPAC4G9.04c |||cleavage and polyadenylation specificity factor |... 25 7.7 >SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1323 Score = 27.5 bits (58), Expect = 1.1 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -3 Query: 252 SWLVTKLSHSTYRPQTHTNRTCTHTYAAPLPHTHKHMYINYTTTRIHVY 106 SW+ K S+ ++ RTCT + AP+ + YI R+HVY Sbjct: 674 SWIGQKYSNVSFEKIDVAERTCTISLNAPILPDDGYAYI-----RLHVY 717 >SPAC4G9.04c |||cleavage and polyadenylation specificity factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 24.6 bits (51), Expect = 7.7 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 264 PPSPSWLVTKLSHSTYRPQTHTNRTCTHTYAAPLPHTHKH 145 P PS + T S Y + TH+Y P P +HK+ Sbjct: 298 PSIPSTIPT--IPSAYSASVSSQPPLTHSYVHPGPQSHKY 335 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,283,857 Number of Sequences: 5004 Number of extensions: 19541 Number of successful extensions: 72 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 180421690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -