BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302E12f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 5.0 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 21 5.0 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 21 8.7 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 21 8.7 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 5.0 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 158 IWSYLKISILHISSTYQLVRRR 223 I + L + ++HISS+ ++ RRR Sbjct: 14 IVTLLVVLLVHISSSERVTRRR 35 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 21.4 bits (43), Expect = 5.0 Identities = 10/31 (32%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -1 Query: 386 CQCSFRPECFAR*NLVK-CSCCRVSSVGRRT 297 C+ +P +K C CCR S + RT Sbjct: 63 CKSQVQPSVITPTGFLKECYCCRESFLRERT 93 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +1 Query: 109 QECGGGFTCKLEG 147 +E GGFTC G Sbjct: 149 EEVAGGFTCPAPG 161 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +1 Query: 109 QECGGGFTCKLEG 147 +E GGFTC G Sbjct: 149 EEVAGGFTCPAPG 161 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,932 Number of Sequences: 336 Number of extensions: 1997 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -