BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302E08f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1A10.04c |cwp1||geranylgeranyltransferase I alpha subunit C... 27 1.7 SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyc... 27 2.2 SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pom... 27 2.2 SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharom... 27 2.2 SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces... 25 5.2 SPBC83.05 |||mitochondrial RNA-binding protein |Schizosaccharomy... 25 9.0 SPAC19E9.03 |pas1|SPAC57A10.01|cyclin Pas1|Schizosaccharomyces p... 25 9.0 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 9.0 >SPAPB1A10.04c |cwp1||geranylgeranyltransferase I alpha subunit Cwp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 294 Score = 27.1 bits (57), Expect = 1.7 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -2 Query: 442 INSVLESNIDLDEEFKENYELW-LEQEVYNNEINWDVLLST*SLIFLANRGKYMVW 278 I++ LE ++ E+F++NY++W Q++ + N++ L +F + Y VW Sbjct: 93 IDNELEWLDEIAEDFQKNYQVWHHRQKILSLTKNYERELEFTKKMFEIDSKNYHVW 148 >SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyces pombe|chr 3|||Manual Length = 430 Score = 26.6 bits (56), Expect = 2.2 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -2 Query: 481 TEQEIDLTPLDTDINSVLESNIDLDEEFKENYELW 377 +E+ + PL+ N+ L + IDL + +E Y+LW Sbjct: 2 SEEVVQDAPLE---NNELNAEIDLQKTIQEEYKLW 33 >SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pombe|chr 1||Partial|Manual Length = 1887 Score = 26.6 bits (56), Expect = 2.2 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -2 Query: 451 DTDINSVLESNI-DLDEEFKENYELWLEQEVYNNEINWDVLL 329 D + N++LE + D DEE +E E+ + N + NW ++ Sbjct: 353 DNNTNTILEDDEKDNDEEEEEEIVNAREKNLLNQQFNWTAIV 394 >SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 26.6 bits (56), Expect = 2.2 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -2 Query: 451 DTDINSVLESNI-DLDEEFKENYELWLEQEVYNNEINWDVLL 329 D + N++LE + D DEE +E E+ + N + NW ++ Sbjct: 353 DNNTNTILEDDEKDNDEEEEEEIVNAREKNLLNQQFNWTAIV 394 >SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces pombe|chr 2|||Manual Length = 897 Score = 25.4 bits (53), Expect = 5.2 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = -2 Query: 490 GTGTEQEIDLTPLDTDINSVLESNIDLDEEFKENYELWLEQEVY 359 G + ++ + L +I++ L NI +EF LW+ Q ++ Sbjct: 455 GMHSSNDLSIRSLAVEIHTTLRYNIYQKQEFGPPVSLWVYQALF 498 >SPBC83.05 |||mitochondrial RNA-binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 24.6 bits (51), Expect = 9.0 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = +3 Query: 201 VAFSFCLSLVAITDNTESTTISQLASQTMYLPLLA 305 V F C L + T NTE +S LASQT Y PL + Sbjct: 364 VLFFDCDRLFSTT-NTEMF-VSTLASQTGYFPLFS 396 >SPAC19E9.03 |pas1|SPAC57A10.01|cyclin Pas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 24.6 bits (51), Expect = 9.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 55 CQRSTFYVFICSLREFLYDNSLAN*KLSRLN 147 C R F V + + +FL D S +N SRL+ Sbjct: 82 CGRRLFLVCLMAATKFLQDRSFSNRAWSRLS 112 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 463 LTPLDTDINSVLESNIDLDEEFKENYE 383 L+ D+ +N E N LD+ FK+ YE Sbjct: 441 LSIFDSFVNKFSELNDSLDQFFKKKYE 467 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,958,254 Number of Sequences: 5004 Number of extensions: 35237 Number of successful extensions: 97 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -