BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302E08f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14990.1 68418.m01758 hypothetical protein 28 4.4 At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, put... 27 5.8 >At5g14990.1 68418.m01758 hypothetical protein Length = 666 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/61 (22%), Positives = 33/61 (54%) Frame = -2 Query: 514 DRFNHRRYGTGTEQEIDLTPLDTDINSVLESNIDLDEEFKENYELWLEQEVYNNEINWDV 335 D + R E+EI +++++ ++ +L+ E ++YE+ LE E + E++W + Sbjct: 459 DEITNNRKAEEEEEEIKSEKIESEVKC-MDCLENLNRE--KDYEILLEDEEFRQELSWII 515 Query: 334 L 332 + Sbjct: 516 V 516 >At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, putative (ERECTA) identical to uncharacterized receptor protein kinase ERECTA [Arabidopsis thaliana] gi|1389566|dbj|BAA11869; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 976 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 195 VIVAFSFCLSLVAITDNTESTTISQL 272 V++ F FCLSLVA + E T+ ++ Sbjct: 8 VLLGFLFCLSLVATVTSEEGATLLEI 33 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,809,087 Number of Sequences: 28952 Number of extensions: 170087 Number of successful extensions: 441 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -