BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302E05f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.7 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 21 8.7 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 21 8.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 369 PSDNGCEFKSSMFEPSTSSY 428 P CE K +PSTSS+ Sbjct: 1147 PKSAKCEEKKPGHKPSTSSW 1166 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 20.6 bits (41), Expect = 8.7 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +3 Query: 120 NLENLDKALHDLGMLSAITEARREYLRETKSNYSVMRL 233 N+ +DK L +LG + + R R + VM L Sbjct: 104 NMTKIDKDLTELGQKKYLEKRNRHIFRTSVLLIFVMHL 141 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 20.6 bits (41), Expect = 8.7 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +3 Query: 120 NLENLDKALHDLGMLSAITEARREYLRETKSNYSVMRL 233 N+ +DK L +LG + + R R + VM L Sbjct: 104 NMTKIDKDLTELGQKKYLEKRNRHIFRTSVLLIFVMHL 141 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,799 Number of Sequences: 336 Number of extensions: 2472 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -