BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302E04f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) 30 1.3 SB_11721| Best HMM Match : Peptidase_C12 (HMM E-Value=0) 29 2.3 >SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) Length = 720 Score = 29.9 bits (64), Expect = 1.3 Identities = 31/90 (34%), Positives = 40/90 (44%), Gaps = 2/90 (2%) Frame = +3 Query: 168 LFYRVTEMATETLVPLES-NPDVLN-KFLQKLGVPNKWNIVDVMGLDPETLSWVPRPVLS 341 L Y TE T L LE P+ N K +K P + V+ +P +L R S Sbjct: 222 LVYEYTEPQTIPLGFLEEVMPEKTNRKPPEKQPAPIHQRLTSVIRKNPLSLEHCERKPRS 281 Query: 342 VMLLFPISDAYENHKKTEENEILSKGQEVS 431 L IS+ E K +ENEILS +E S Sbjct: 282 STTLMAISE--ETMKNHQENEILSSVEESS 309 >SB_11721| Best HMM Match : Peptidase_C12 (HMM E-Value=0) Length = 537 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +3 Query: 333 VLSVMLLFPISDAYENHKKTEE-NEILSKGQEVSGNIFYMKQNISNACGTIALVHSVXXN 509 V + LF + + +K + +E + +E+ +IF+ +Q I N+C T AL+ SV N Sbjct: 27 VYGFIFLFKWIEERRSRRKIQHIDESFVENEEIVNDIFFAQQVIPNSCATHALL-SVLLN 85 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,821,019 Number of Sequences: 59808 Number of extensions: 309853 Number of successful extensions: 607 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -