BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302E04f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 25 0.62 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 3.3 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 22 4.4 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 5.8 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 5.8 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 24.6 bits (51), Expect = 0.62 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 381 HKKTEENEILSKGQEVSGNIFYMKQNISNACGTIAL 488 H+K ++ I + + N FY K N SN+ + L Sbjct: 123 HQKLDQKFIFPQENNYNDNYFYSKSNGSNSSNSDVL 158 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 186 EMATETLVPLESNPDVLNKFLQK 254 ++ E LVPLE N + NK+ K Sbjct: 863 KIVPEELVPLEGNLMINNKYALK 885 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.8 bits (44), Expect = 4.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 73 INSTIWYVFNSIVNLRRY 126 IN I+ FNS+V RR+ Sbjct: 19 INYFIFLYFNSLVRFRRF 36 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 195 TETLVPLESNPDVLNKFLQKLG 260 T+TL L +PD L K Q G Sbjct: 889 TQTLDKLIRSPDTLRKIAQNRG 910 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -1 Query: 359 WEK*HYRKHRARYPRKRFRIK 297 W+K +K ++ PR++F K Sbjct: 427 WKKGRDKKSTSKKPRRKFHFK 447 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,976 Number of Sequences: 438 Number of extensions: 2989 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -