BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302D10f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 9.4 SB_18107| Best HMM Match : DUF270 (HMM E-Value=0.0004) 27 9.4 >SB_36523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 401 YDWLYFFFIILXGTVLTLGIVYKTRSFKRGQNGL 502 +DWL+F F L ++T +V ++R K+ G+ Sbjct: 96 FDWLFFVFFTLSSCIVTSWLVVQSRGLKQLSCGI 129 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 113 EKKNTLKLSINSRFEYCNLTPSVILHDLKRYVKI 12 +KKN+ KL +R +Y +T S+ L RYV+I Sbjct: 2154 KKKNSWKLYNGNRDQYSTVTESINPPILARYVRI 2187 >SB_18107| Best HMM Match : DUF270 (HMM E-Value=0.0004) Length = 595 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 429 IIKKKYNQSYRSFPDRKKKHTKSK-STFLNRILLF 328 + +KK + PDR KK KSK S F++ L+F Sbjct: 35 VYEKKIENETANTPDRAKKEKKSKYSRFVSTSLMF 69 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,582,807 Number of Sequences: 59808 Number of extensions: 173561 Number of successful extensions: 369 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -