BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302D10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 4.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 4.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 4.4 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -3 Query: 453 RVSTVPXKIIKKKYNQSYRSFPDRKKKHTKSKSTFLNR 340 R TVP K + KY P +K + +T L R Sbjct: 321 RKKTVPLKKVNSKYILKSTLTPKLARKQFQKNTTGLER 358 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 4.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 386 SGKLRYDWLYFFFIILXGTVLTLGIVYKTRSF 481 +G L W+ +F I G T +VY T F Sbjct: 210 AGTLAVVWIMCYFCIWKGVKWTGKVVYFTSLF 241 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 4.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 386 SGKLRYDWLYFFFIILXGTVLTLGIVYKTRSF 481 +G L W+ +F I G T +VY T F Sbjct: 263 AGTLAVVWIMCYFCIWKGVKWTGKVVYFTSLF 294 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,152 Number of Sequences: 438 Number of extensions: 1886 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -