BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302D09f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 27 0.50 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 8.2 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 26.6 bits (56), Expect = 0.50 Identities = 14/61 (22%), Positives = 28/61 (45%) Frame = -2 Query: 322 RAYKSAAEFAADVRLIFTNCYKYNPPDHDVVAMARKLQDVFEMRYAKIPDEPVHVAAHAE 143 R + ++ A RLIF + KYN P ++ ++ Y +I + + AA++ Sbjct: 22 RRREGKTDYYARKRLIFQDKNKYNTPKFRLIVRLSNRDITCQIAYRRIEGDRIVCAAYSH 81 Query: 142 K 140 + Sbjct: 82 E 82 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 468 LKNFSLRNTLAMPGHFINLLMLNYLGY 388 L+ +LRN IN L+ NYL Y Sbjct: 198 LRTATLRNDFEGQAVLINCLLRNYLHY 224 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 484,334 Number of Sequences: 2352 Number of extensions: 8876 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -