BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302D07f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2058| Best HMM Match : Lactamase_B (HMM E-Value=1.7e-16) 79 2e-15 SB_18301| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_37595| Best HMM Match : Ribosomal_S11 (HMM E-Value=0) 45 3e-05 SB_39193| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.029) 30 1.3 SB_43219| Best HMM Match : zf-CCHC (HMM E-Value=0.0056) 28 5.4 SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11) 28 5.4 SB_27574| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_49500| Best HMM Match : Collagen (HMM E-Value=1.8e-07) 27 7.1 >SB_2058| Best HMM Match : Lactamase_B (HMM E-Value=1.7e-16) Length = 338 Score = 79.4 bits (187), Expect = 2e-15 Identities = 36/65 (55%), Positives = 47/65 (72%) Frame = -3 Query: 519 GHICYFVTAPEEGNDSVVFTGDTLFLGGCGRFFEGTADQMYKALITILSSLPDHTKVFCG 340 GHIC+ VT + G + VFTGDTLF GGCGRFFEG+ +MY ALI +L SLP++T+ Sbjct: 231 GHICFHVTG-DAGKPTAVFTGDTLFSGGCGRFFEGSPPEMYSALIEVLGSLPENTEKRAH 289 Query: 339 HEYTL 325 +E T+ Sbjct: 290 NEPTI 294 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/26 (61%), Positives = 21/26 (80%) Frame = -3 Query: 252 DRRNQGKPTVPSTIGEEKLYNPFMRV 175 ++R +PT+PSTIGEE +NPFMRV Sbjct: 285 EKRAHNEPTIPSTIGEEFSFNPFMRV 310 >SB_18301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 74.5 bits (175), Expect = 5e-14 Identities = 40/92 (43%), Positives = 57/92 (61%), Gaps = 8/92 (8%) Frame = -3 Query: 339 HEYTLQNLKFAAHVEPTNENVKAKISWSQDRRNQGKPTVPSTIGEEKLYNPFMRVTELAV 160 H+Y ++NL FA +EP+N +++AK+ W + RN T PSTIGEEKLYNPF+R T LA+ Sbjct: 2 HDYAMKNLMFALTIEPSNYHLRAKMDWVVEMRNNKYMTSPSTIGEEKLYNPFLR-THLAI 60 Query: 159 ----QNHTGKND----PIDTMKAIRLEKDTFK 88 T +D + +KA+R K+ FK Sbjct: 61 VGSAVGFTQDDDVNLRAVSVLKALRERKNNFK 92 >SB_37595| Best HMM Match : Ribosomal_S11 (HMM E-Value=0) Length = 543 Score = 45.2 bits (102), Expect = 3e-05 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 2/50 (4%) Frame = -3 Query: 471 VVFTGDTLFLGGCGR--FFEGTADQMYKALITILSSLPDHTKVFCGHEYT 328 + FTGD L + CGR F EG+A+++Y+++ + + SLP ++ GH+YT Sbjct: 450 MAFTGDALLIRACGRTDFQEGSAEKLYESVHSKILSLPRDFTLYPGHDYT 499 >SB_39193| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.029) Length = 1769 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 469 CLHRGYTLLRRMWQVL*RHGRSNVQSINNNSEQPA 365 CLH+G L ++W VL R GR N +I + E A Sbjct: 1231 CLHKGPPLQNKIWGVLVR-GRFNTVAITDGEESDA 1264 >SB_43219| Best HMM Match : zf-CCHC (HMM E-Value=0.0056) Length = 693 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 469 CLHRGYTLLRRMWQVL*RHGRSNVQSINNNSEQ 371 CLH+G L ++W VL R GR N +I + ++ Sbjct: 636 CLHKGPPLQNKIWDVLVR-GRFNTVAITGDLQK 667 >SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11) Length = 1461 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 469 CLHRGYTLLRRMWQVL*RHGRSNVQSINNNSEQ 371 CLH+G L ++W VL R GR N +I + ++ Sbjct: 595 CLHKGPPLQNKIWDVLVR-GRFNTVAITGDLQK 626 >SB_27574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 469 CLHRGYTLLRRMWQVL*RHGRSNVQSINNNSEQ 371 CLH+G L ++W VL R GR N +I + ++ Sbjct: 463 CLHKGPPLQNKIWDVLVR-GRFNTVAITGDLQK 494 >SB_49500| Best HMM Match : Collagen (HMM E-Value=1.8e-07) Length = 621 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +2 Query: 248 LSCDQLILALTFSLVGST*AANF--KFCKVYSWPQNTLVWSG 367 + C+Q LVG++ A N + C+ YS+P L WSG Sbjct: 319 MRCEQQTPGYQQPLVGNSTALNACKEHCEAYSFPVFVLKWSG 360 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,250,490 Number of Sequences: 59808 Number of extensions: 326234 Number of successful extensions: 700 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -