BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302D07f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 23 4.7 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 23 4.7 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 23.4 bits (48), Expect = 4.7 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 496 CSRRRKRFSCLHRGYTLLRR 437 C R + F C H+ Y LR+ Sbjct: 133 CERAHRSFLCYHQHYGYLRK 152 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 23.4 bits (48), Expect = 4.7 Identities = 7/33 (21%), Positives = 24/33 (72%) Frame = -3 Query: 204 EKLYNPFMRVTELAVQNHTGKNDPIDTMKAIRL 106 E++ + +R+T++ ++ +++P++ ++A+RL Sbjct: 31 EEIASHQIRITQIVPRDGWTEHNPVEVLEAVRL 63 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 564,115 Number of Sequences: 2352 Number of extensions: 12083 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -