BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302D05f (492 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 1.3 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 1.8 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 4.1 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 5.4 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 5.4 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 21 5.4 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 7.1 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 9.4 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 9.4 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 1.3 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +1 Query: 190 LPINIMYNYPGVE 228 LP+NI ++YPG E Sbjct: 612 LPLNIRWSYPGEE 624 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 170 SRWRYLIRNRGRLWCAYRTVNFRL 99 ++WR+L++ L C+ R +N RL Sbjct: 68 NKWRFLLQCLEDLDCSLRKLNSRL 91 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +3 Query: 36 QYPQQRPITEVIG 74 +Y Q +PI+EVIG Sbjct: 951 EYYQNKPISEVIG 963 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 400 LHLSPYITQCNPLSSRLW 453 L++SP ++ N +SR+W Sbjct: 620 LYVSPVSSEYNQYNSRIW 637 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 400 LHLSPYITQCNPLSSRLW 453 L++SP ++ N +SR+W Sbjct: 620 LYVSPVSSEYNQYNSRIW 637 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 21.4 bits (43), Expect = 5.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 212 LYIMLIGKSLSWDRSRWR 159 LYI+L+G WD + R Sbjct: 102 LYILLVGYPPFWDEDQHR 119 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.0 bits (42), Expect = 7.1 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +1 Query: 127 HHNRPRFLIKYRHLDLSQLRLLPINIMYNYPGVE 228 H N P FL + L L P MY+ G E Sbjct: 121 HDNSPSFLSDHSRDQEQNLYLTPSPQMYSSGGEE 154 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.6 bits (41), Expect = 9.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 102 SEIDSPVGTPQPPAIPNQVSPPGPIP 179 S IDS T + A Q PP P P Sbjct: 1336 SSIDSDYSTLERTAWRQQQPPPPPPP 1361 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 20.6 bits (41), Expect = 9.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 139 PRFLIKYRHLDLSQLRLLPINIMYN 213 P +LIK+++ DL PI+ + N Sbjct: 259 PTYLIKWKNWDLKYNTWEPISNLIN 283 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,123 Number of Sequences: 438 Number of extensions: 2700 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -