BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302D03f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synth... 266 9e-74 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 1.9 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 23 1.9 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 4.4 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 4.4 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 7.7 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 7.7 >AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synthase 16 kDa proteolipidsubunit protein. Length = 156 Score = 266 bits (652), Expect = 9e-74 Identities = 132/144 (91%), Positives = 137/144 (95%) Frame = +2 Query: 71 ENNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGI 250 E++PIY PFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGI Sbjct: 4 EDHPIYAPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGI 63 Query: 251 IAIYGLVVAVLIAGALQEPANYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTA 430 IAIYGLVVAVLIAG L+EP Y L+KGF+HLGAGLAVGFSGLAAGFAIGIVGDAGVRGTA Sbjct: 64 IAIYGLVVAVLIAGGLEEPKGYTLFKGFVHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTA 123 Query: 431 QQPRLFVGMILILIXAEVXGLYGL 502 QQPRLFVGMILILI AEV GLYGL Sbjct: 124 QQPRLFVGMILILIFAEVLGLYGL 147 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 286 NQDSHDQTVDGNNTRHDDRNDRLHDQLRPHHRH 188 NQ H D N ++ ND+ H + ++RH Sbjct: 430 NQARHSSKSDNQN--NNQHNDQAHHSSKSNNRH 460 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -2 Query: 286 NQDSHDQTVDGNNTRHDDRNDRLHDQLRPHHRH 188 NQD++ + N RH ++D ++ H Sbjct: 419 NQDNNHYNHNHNQARHSSKSDNQNNNQHNDQAH 451 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 69 LKIIQSTDPSLELWGRRLLSSS 134 + I + TDP E W RR L S Sbjct: 142 MTITELTDPVKEFWERRALQIS 163 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.8 bits (44), Expect = 4.4 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +2 Query: 236 VMAGIIAIYGLVVAVLIAGALQEPANY 316 +++G+I GL++ VLI G++ E + Sbjct: 413 IVSGLIT--GLIMRVLICGSISEEQKF 437 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 4.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 209 LIMKSIIPVVMAGIIAIYGLVVAVLIAGALQEPANYPL 322 L++ SII + G I + VAV + L+ P NY L Sbjct: 46 LVLGSIIVGTVIGNILV---CVAVFLVRKLRRPCNYLL 80 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.0 bits (42), Expect = 7.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -3 Query: 411 ASPTMPMAKPAARPENPTAKPAPKWMNPL 325 AS TM M K PEN W N L Sbjct: 51 ASKTMAMMKGEYIPENALPVGIEIWRNKL 79 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 106 YGGGVCYHLQR 138 YG G+ YHL + Sbjct: 487 YGAGIVYHLSK 497 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,839 Number of Sequences: 438 Number of extensions: 3256 Number of successful extensions: 15 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -