BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302D01f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164151-1|AAD47075.1| 148|Anopheles gambiae translation initia... 210 3e-56 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 29 0.13 AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. 23 8.2 >AF164151-1|AAD47075.1| 148|Anopheles gambiae translation initiation factor 4C (1A) protein. Length = 148 Score = 210 bits (512), Expect = 3e-56 Identities = 95/108 (87%), Positives = 103/108 (95%) Frame = +2 Query: 140 LVFKEDGQEYAQVTKMLGNGRLEAMCFDGIKRLCHIRGKLRKKVWINQGDIILIGLRDYQ 319 L+FKED QEYAQVTKMLGNGRLEAMCFDG+KRLCHIRGKLRKKVWINQGDIILIGLRDYQ Sbjct: 26 LIFKEDEQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINQGDIILIGLRDYQ 85 Query: 320 DAKADVILKYTPDEARNLKTYGEFPETVRINETVVYSVDGLDEDIEFG 463 D+KADVILKYTPDEARNLKTYGEFPE+VRINETV + + +D+DIEFG Sbjct: 86 DSKADVILKYTPDEARNLKTYGEFPESVRINETVTFVENDMDDDIEFG 133 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 28.7 bits (61), Expect = 0.13 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 263 KKVWINQGDIILIGLRDYQDAKADVILKYTPDEARNLKTYGEFP 394 K+ ++ + +++ + Y K IL+YT D R K Y EFP Sbjct: 757 KRYLVHAIENLIVVIVIYDKCKDVAILQYTSDRWRQQKYYDEFP 800 >AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. Length = 187 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 314 YQDAKADVILKYTPDEARNLKTYGE 388 + D DVI++ TPD R + Y E Sbjct: 93 WADTIEDVIMRSTPDGMRIKQIYSE 117 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 438,928 Number of Sequences: 2352 Number of extensions: 8465 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -