BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302C11f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024806-3|AAP13749.1| 363|Caenorhabditis elegans Serpentine re... 28 4.7 Z35601-4|CAO82063.1| 145|Caenorhabditis elegans Hypothetical pr... 27 8.1 Z35601-3|CAO82062.1| 185|Caenorhabditis elegans Hypothetical pr... 27 8.1 Z35600-6|CAO82037.1| 145|Caenorhabditis elegans Hypothetical pr... 27 8.1 Z35600-5|CAO82036.1| 185|Caenorhabditis elegans Hypothetical pr... 27 8.1 >AC024806-3|AAP13749.1| 363|Caenorhabditis elegans Serpentine receptor, class w protein40 protein. Length = 363 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 359 NNCRRSRHEWLFTYYGIEAINGVSGVVHDTTCAVGF 252 N SR+ W+F Y + I + V T C VGF Sbjct: 14 NFSEESRNFWVFIYLKVRCIRFYADFVSFTICFVGF 49 >Z35601-4|CAO82063.1| 145|Caenorhabditis elegans Hypothetical protein R10E9.3b protein. Length = 145 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/40 (25%), Positives = 24/40 (60%) Frame = -1 Query: 305 AINGVSGVVHDTTCAVGFNQRVRSLNQISIAFFLLTFVIT 186 A +GVS +V + T +GF+ + + ++ A +L+ +++ Sbjct: 23 ADDGVSTIVEERTTMLGFSSFLIGVKSVTFAIYLVLLIVS 62 >Z35601-3|CAO82062.1| 185|Caenorhabditis elegans Hypothetical protein R10E9.3a protein. Length = 185 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/40 (25%), Positives = 24/40 (60%) Frame = -1 Query: 305 AINGVSGVVHDTTCAVGFNQRVRSLNQISIAFFLLTFVIT 186 A +GVS +V + T +GF+ + + ++ A +L+ +++ Sbjct: 23 ADDGVSTIVEERTTMLGFSSFLIGVKSVTFAIYLVLLIVS 62 >Z35600-6|CAO82037.1| 145|Caenorhabditis elegans Hypothetical protein R10E9.3b protein. Length = 145 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/40 (25%), Positives = 24/40 (60%) Frame = -1 Query: 305 AINGVSGVVHDTTCAVGFNQRVRSLNQISIAFFLLTFVIT 186 A +GVS +V + T +GF+ + + ++ A +L+ +++ Sbjct: 23 ADDGVSTIVEERTTMLGFSSFLIGVKSVTFAIYLVLLIVS 62 >Z35600-5|CAO82036.1| 185|Caenorhabditis elegans Hypothetical protein R10E9.3a protein. Length = 185 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/40 (25%), Positives = 24/40 (60%) Frame = -1 Query: 305 AINGVSGVVHDTTCAVGFNQRVRSLNQISIAFFLLTFVIT 186 A +GVS +V + T +GF+ + + ++ A +L+ +++ Sbjct: 23 ADDGVSTIVEERTTMLGFSSFLIGVKSVTFAIYLVLLIVS 62 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,926,849 Number of Sequences: 27780 Number of extensions: 125898 Number of successful extensions: 398 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -