BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302C01f (500 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 27 0.11 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 25 0.59 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 5.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 7.2 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 9.5 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 9.5 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 27.1 bits (57), Expect = 0.11 Identities = 22/87 (25%), Positives = 40/87 (45%) Frame = +1 Query: 7 PNKMKLLVVFAMCMLAASAGVVELSADTSNQDLEEKLYNSILTGDYDSAVRQSLEYESQG 186 P +KLLV+ + + + ++ E+++ ++IL G YD+ +R S E + G Sbjct: 3 PGVLKLLVLLTFLLHPSRC----TQGKVNYREKEKEVLDNIL-GGYDARIRPSGENATDG 57 Query: 187 KGSIIQNVVNNLIIDKRRNTMEYCYKL 267 + N+ I TMEY +L Sbjct: 58 PAVVRVNIFVRSISKIDDVTMEYSVQL 84 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 24.6 bits (51), Expect = 0.59 Identities = 21/87 (24%), Positives = 39/87 (44%) Frame = +1 Query: 7 PNKMKLLVVFAMCMLAASAGVVELSADTSNQDLEEKLYNSILTGDYDSAVRQSLEYESQG 186 P +KLLV+ + + + ++ E+++ ++IL G YD+ +R S E + G Sbjct: 3 PGVLKLLVLLTFLLHPSRC----TQGKVNYREKEKEVLDNIL-GGYDARIRPSGENATDG 57 Query: 187 KGSIIQNVVNNLIIDKRRNTMEYCYKL 267 + N+ I MEY +L Sbjct: 58 PAIVRVNLFVRSIATISDIKMEYSVQL 84 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 5.5 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 83 ADSSTTPALAASMHIANTTRSFI 15 A+ + +A +HI+N T SF+ Sbjct: 396 ANKMESSGMAGRVHISNATLSFL 418 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +1 Query: 427 DGVDKHTELVSWK 465 D +D+HT V+WK Sbjct: 986 DDLDQHTLKVTWK 998 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = -1 Query: 254 YSMVFRLLSMIRLLTTFWMMEPLPWL 177 Y+M F T F ++P PW+ Sbjct: 213 YNMTFAQNGPFNTTTIFVPVKPCPWI 238 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 20.6 bits (41), Expect = 9.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 95 LEVSADSSTTPALAASMHIANTTRSFIL 12 LE S S +P + +NT+++FIL Sbjct: 80 LERSKTKSKSPESRDRSNTSNTSKTFIL 107 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 20.6 bits (41), Expect = 9.5 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 Query: 126 AVVQFLLEVLVRSVRG*FNDARAGGEHAHRKYN 28 A V+ ++V++ + G NDA G YN Sbjct: 107 AGVRIYVDVIMNHMSGDRNDAHGTGNSRANTYN 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,908 Number of Sequences: 438 Number of extensions: 3038 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -