BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302B12f (462 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 3.0 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 23 5.2 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.8 bits (49), Expect = 3.0 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 307 RYVSSPYIF*TNLVITLNSDLLRLSGFLV*TFLYCLIFMKS 429 R + +IF + LN+++ +SG L TF C I MK+ Sbjct: 473 RVIEPIFIFVMAYLAYLNAEIFHMSGILAITF--CGITMKN 511 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.0 bits (47), Expect = 5.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 135 YIRSRSYCWGDQCSRSTR 82 Y+RSR W D+C TR Sbjct: 21 YLRSRHNYWRDRCFPYTR 38 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 331,402 Number of Sequences: 2352 Number of extensions: 6008 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39969834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -