BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302B04f (488 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0072 + 13218669-13218706,13218715-13218781,13220400-132204... 28 4.6 03_02_0164 - 6066744-6067637 27 6.1 01_01_0443 - 3314002-3314565 27 8.1 >12_02_0072 + 13218669-13218706,13218715-13218781,13220400-13220471, 13222107-13222182,13222309-13222943 Length = 295 Score = 27.9 bits (59), Expect = 4.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 233 PAPPKQIYVPPPQKHY 280 P PP YVPPPQ +Y Sbjct: 264 PPPPAYPYVPPPQYYY 279 >03_02_0164 - 6066744-6067637 Length = 297 Score = 27.5 bits (58), Expect = 6.1 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 84 NHHHHTALLPHPMGLHR-GLMVPQPHNMVPHNS 179 +HHHH LL +P HR GL P + H S Sbjct: 151 HHHHHHQLLGYPQHHHRFGLAGPTVAALYQHPS 183 >01_01_0443 - 3314002-3314565 Length = 187 Score = 27.1 bits (57), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 233 PAPPKQIYVPPPQKH 277 P PP+Q Y PPP H Sbjct: 30 PPPPQQQYTPPPPAH 44 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,501,735 Number of Sequences: 37544 Number of extensions: 210462 Number of successful extensions: 706 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -