BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302B03f (421 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 1.1 AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. 24 2.6 AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine pr... 24 2.6 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 23 4.5 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 4.5 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 25.0 bits (52), Expect = 1.1 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 129 KIEMTVTGANDRPVKDVVISDTKTEVVAEPFSVT 230 K EMTV + +P +D+ I+ TEV PFS T Sbjct: 714 KTEMTVISSLQQPPEDITITVGGTEV---PFSRT 744 >AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. Length = 380 Score = 23.8 bits (49), Expect = 2.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 132 FSVQHPFLLKLYRKQHVCHLTRVS 61 F+V HPFL L +Q V + RV+ Sbjct: 353 FTVDHPFLYVLRHQQMVYFVGRVA 376 >AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine protease inhibitor protein. Length = 380 Score = 23.8 bits (49), Expect = 2.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 132 FSVQHPFLLKLYRKQHVCHLTRVS 61 F+V HPFL L +Q V + RV+ Sbjct: 353 FTVDHPFLYVLRHQQMVYFVGRVA 376 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 23.0 bits (47), Expect = 4.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 6 MANAGKDTNGSQFFITTVKTPWLD 77 ++N KDT G QF+ +K WLD Sbjct: 323 LSNTFKDTTGQQFY-DNIKR-WLD 344 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 4.5 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -1 Query: 148 VTVISIFCTTSIPSKTLPKTTCLPSN 71 V + ++C S+P+ PK PS+ Sbjct: 801 VAISPLYCEGSVPTLQSPKNAVAPSD 826 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 368,934 Number of Sequences: 2352 Number of extensions: 7029 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -