BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302B02f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 2.5 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 5.8 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 7.7 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.6 bits (46), Expect = 2.5 Identities = 13/48 (27%), Positives = 18/48 (37%) Frame = +1 Query: 376 IFESYQDGSDTYELGWFGPWWAAACKAQEELPERCEAFGRVSVTADFF 519 +F ++ S ELGWF AA P + S + FF Sbjct: 53 LFSGPEESSGGVELGWFNDSAAAITSTSPSYPGGGSSSPSPSSPSSFF 100 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +3 Query: 300 CATKCYQGSNQD*VQEGQCCW 362 C+ C G + V QCCW Sbjct: 587 CSLPCEVGQAKKYVAGEQCCW 607 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -1 Query: 203 LLKIIRNLT*RASAFFLRRPWPFTAPAR 120 L+ I ++ FFLR+ +PF P++ Sbjct: 220 LIYFIEDIGLNTYYFFLRQAFPFWLPSK 247 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 161 FFLRRPWPFTAPAR 120 FFLR+ +PF P++ Sbjct: 234 FFLRQAFPFWLPSK 247 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,314 Number of Sequences: 438 Number of extensions: 2761 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -