BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302B01f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharo... 27 1.7 SPAC6G9.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 26 3.9 SPBC19G7.01c |msh2|swi8, mut3, SPBC24C6.12c|MutS protein homolog... 25 5.2 SPAC6F12.14 |cut23|apc8|anaphase-promoting complex subunit Apc8 ... 25 6.8 >SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharomyces pombe|chr 1|||Manual Length = 969 Score = 27.1 bits (57), Expect = 1.7 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 518 RTTVRD-ATQSAYTYYERDAMSLHFCFV*CVVSRKKRFDRTLYSIKNCK 375 R ++D A S Y Y R+ H C + S KR +RT++ +CK Sbjct: 82 RMRIKDYALMSGYDSYHRECFRCHDCRKQIIDSNFKRDNRTIF-CNDCK 129 >SPAC6G9.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 681 Score = 25.8 bits (54), Expect = 3.9 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 205 FSIFVLKYLYELNN-NHLTHDLAY-LYK 128 F +VL+Y+ ELNN NH ++Y LYK Sbjct: 537 FGNYVLQYVLELNNPNHTEAIISYFLYK 564 >SPBC19G7.01c |msh2|swi8, mut3, SPBC24C6.12c|MutS protein homolog 2|Schizosaccharomyces pombe|chr 2|||Manual Length = 982 Score = 25.4 bits (53), Expect = 5.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 196 FVLKYLYELNNNHLTHDLAYLY 131 F K L+ LNN+++ H +Y Y Sbjct: 568 FTTKRLHSLNNSYMDHQKSYRY 589 >SPAC6F12.14 |cut23|apc8|anaphase-promoting complex subunit Apc8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 565 Score = 25.0 bits (52), Expect = 6.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 416 KRFDRTLYSIKNCKS 372 K F+R Y+++NCKS Sbjct: 101 KEFERAAYTLQNCKS 115 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,797,183 Number of Sequences: 5004 Number of extensions: 30109 Number of successful extensions: 64 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -