BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302B01f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08190.1 68414.m00905 vacuolar assembly protein, putative (VP... 31 0.47 At1g02730.1 68414.m00226 cellulose synthase family protein simil... 27 7.7 >At1g08190.1 68414.m00905 vacuolar assembly protein, putative (VPS41) 99.8% identical to Vacuolar assembly protein VPS41 homolog (SP:P93043) [Arabidopsis thaliana]; similar to vacuolar assembly protein vps41 GI:1835787 from [Lycopersicon esculentum] Length = 980 Score = 31.1 bits (67), Expect = 0.47 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +1 Query: 1 PKLQTFMVLLMTSYRSFISINNRID*VLFVRSDSILTVFFKQACKGT-LSHE*DD 162 P+L+ +V ++T YR+ S+ + + +L ++L F +A +G LSHE DD Sbjct: 794 PRLRDRLVKIVTDYRTETSLRHGCNDILKTDIVNLLVKCFNEARRGVCLSHEDDD 848 >At1g02730.1 68414.m00226 cellulose synthase family protein similar to cellulose synthase catalytic subunit [gi:13925881] from Nicotiana alata, cellulose synthase-4 [gi:9622880] from Zea mays Length = 1181 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +3 Query: 399 GAVESFFSRNHALYKTK 449 G+VE FFSRN+A++ T+ Sbjct: 929 GSVEIFFSRNNAIFATR 945 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,696,165 Number of Sequences: 28952 Number of extensions: 133776 Number of successful extensions: 231 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 231 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -