BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302A11f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 25 0.62 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 24.6 bits (51), Expect = 0.62 Identities = 25/77 (32%), Positives = 36/77 (46%) Frame = -1 Query: 518 QFQQMRAVIQQNPNLLNAVLQQIGQTNPALLQVISQHQEAFVRMLNEPVNPSAAGVASDE 339 Q QQ + V QQ + AV QQ Q + Q+I HQ++ + +N S + V S + Sbjct: 771 QVQQAQQVQQQMQAAMAAV-QQSQQRHQHAAQMIYGHQQSHHGL---HINSSPSSVQSGQ 826 Query: 338 NVADIQQPQLGSQNVIQ 288 + Q LG Q V Q Sbjct: 827 QQQSVLQ-GLGVQGVQQ 842 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,888 Number of Sequences: 438 Number of extensions: 1949 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -