BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302A07f (448 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 4.6 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 4.6 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 4.6 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 21 8.1 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 4.6 Identities = 13/57 (22%), Positives = 25/57 (43%) Frame = +2 Query: 71 DFGSRRPRRLLDQHFGLALTPDDLLSVAAGPLLNREYYRPWRHLAAAARDVGSSIKV 241 D G D + L + L+V A P+L + + ++L R+ G++ K+ Sbjct: 329 DLGKLGEEEKADWWKDIMLLNEKTLAVPAPPVLPENHLKNAKYLDVIERNSGATDKI 385 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 4.6 Identities = 13/57 (22%), Positives = 25/57 (43%) Frame = +2 Query: 71 DFGSRRPRRLLDQHFGLALTPDDLLSVAAGPLLNREYYRPWRHLAAAARDVGSSIKV 241 D G D + L + L+V A P+L + + ++L R+ G++ K+ Sbjct: 329 DLGKLGEEEKADWWKDIMLLNEKTLAVPAPPVLPENHLKNAKYLDVIERNSGATDKI 385 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 4.6 Identities = 13/57 (22%), Positives = 25/57 (43%) Frame = +2 Query: 71 DFGSRRPRRLLDQHFGLALTPDDLLSVAAGPLLNREYYRPWRHLAAAARDVGSSIKV 241 D G D + L + L+V A P+L + + ++L R+ G++ K+ Sbjct: 329 DLGKLGEEEKADWWKDIMLLNEKTLAVPAPPVLPENHLKNAKYLDVIERNSGATDKI 385 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 20.6 bits (41), Expect = 8.1 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 5 QAIFGSNLQ*KARMSLLPYFF-DDFGSRRPRRLLDQHFGLALTPDD 139 Q + G + R LP+F DD+G R ++ + LTP + Sbjct: 252 QNVEGKRIPFGFRKRTLPHFIKDDYGP-ESRGFVENSYLAGLTPSE 296 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,152 Number of Sequences: 438 Number of extensions: 1831 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11697255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -