BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302A04f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) 25 1.0 SB_52928| Best HMM Match : PKD (HMM E-Value=0) 29 3.1 SB_20858| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) 28 5.4 SB_23517| Best HMM Match : WD40 (HMM E-Value=0) 27 7.1 SB_24957| Best HMM Match : Terminase_4 (HMM E-Value=2.7) 27 9.4 SB_55864| Best HMM Match : Sad1_UNC (HMM E-Value=6.9e-25) 27 9.4 SB_3889| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/65 (30%), Positives = 27/65 (41%) Frame = -1 Query: 278 CRPTACSSTPWCSVSCQ*SGC*LHSG*WSPCLGSHIPSSDGQHCRSRR*GCCCTVSPRGL 99 C+ CS++ C SC GC L+ + + C+SR G CT S G Sbjct: 224 CQQVVCSASGKCDQSCDGEGCNLYCSEGAKTCNQKCQGACVTDCKSRWCGVTCTGS--GC 281 Query: 98 G*KCP 84 KCP Sbjct: 282 DVKCP 286 >SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) Length = 290 Score = 25.4 bits (53), Expect(2) = 1.0 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = +2 Query: 212 VNNLIIDKRRNTMEYCYKLWVGNGQEIV 295 +++L++ +++ YC+ NGQ+IV Sbjct: 130 IHDLLLSLQKHLFAYCHNATSNNGQDIV 157 Score = 23.4 bits (48), Expect(2) = 1.0 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +2 Query: 293 VRKYFPLNFRLIMAGNYVKIIYRNYNLALKLGSTTNPSNERIAYGDGVDKH 445 +R YF L+M+G ++ + +L L S R+ G G D H Sbjct: 183 IRYYFACFQELLMSGPANSLLQSHLSLFLPCAGEILGSVYRLLVGHGSDTH 233 >SB_52928| Best HMM Match : PKD (HMM E-Value=0) Length = 1624 Score = 28.7 bits (61), Expect = 3.1 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 3/113 (2%) Frame = -3 Query: 339 FPAMMSLKFNGKYFLTISCPLPTHSL*QYSMVFRLLSMIRLLTTFWMMEPLP---WLSYS 169 FPAM +L NG + +++ SL ++ R R L M P+ W S Sbjct: 519 FPAMAALTMNGSHAVSLWSYGDGSSLKKHESGPRQFITSRHLYAHTGMFPVTVTVWNRLS 578 Query: 168 KL*RTALS*SPVRMLLYSFSSRSWLEVSADSSTTPALAASMHIANTTRSFILL 10 K TAL+ V++ + + S S L S +S T + + H T S+ ++ Sbjct: 579 KKNETALAYVSVQVPVTNISVPSDLTASLGNSVTFTVKITSHETPTNASYYII 631 >SB_20858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 313 KL*THHGRKLCQDHLQKLQPRSEAR 387 +L HHGR+L +DHL PR R Sbjct: 199 RLLKHHGRELIKDHLDLPLPRQPKR 223 >SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) Length = 1514 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +3 Query: 51 SPPARASLNYPRTLLTKTSRRNCTTASSPATTTVLSVRAWNMRAKAR 191 +PP+R S R+ SR T S+P T + S RA + R KA+ Sbjct: 1359 APPSRTSTPRSRSTPRSRSRSRTRTPSTPFTPSTTSSRA-SSRGKAK 1404 >SB_23517| Best HMM Match : WD40 (HMM E-Value=0) Length = 860 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 6/38 (15%) Frame = +3 Query: 102 TSRRNCTTASSPATTTVLS------VRAWNMRAKARAP 197 TSR NC + P +T ++S +R W+ R++++ P Sbjct: 655 TSRVNCVKFNQPDSTVIISGSYDSTIRCWDCRSRSQEP 692 >SB_24957| Best HMM Match : Terminase_4 (HMM E-Value=2.7) Length = 354 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -2 Query: 478 QGNELPTDEFSMLVYTIAVGNSLIRGIGCGTELQSEVVVSVN 353 Q NE+ +FS + T+ R IGC T Q + VV+ N Sbjct: 274 QHNEMEISKFSTVTATVLGVQKASRSIGC-TSCQRQTVVTPN 314 >SB_55864| Best HMM Match : Sad1_UNC (HMM E-Value=6.9e-25) Length = 526 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -1 Query: 308 GSTF*QFPVRCRPTA-CSSTPWCSVSC 231 G T + RP A CS +PWC ++C Sbjct: 270 GDTNNNVTIAARPKAWCSCSPWCVLTC 296 >SB_3889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -3 Query: 216 LTTFWMMEPLPWLSYSKL*RTALS*SPVRMLLYSFSSRSWLEVSA 82 + F ++PL L+YS+ RTA+ P ++ + R+W E A Sbjct: 185 VVNFEPLKPLFMLAYSRS-RTAIPAGPALPNIFGYPHRNWKEAGA 228 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,575,932 Number of Sequences: 59808 Number of extensions: 340753 Number of successful extensions: 899 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 898 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -