BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302A04f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical prote... 25 1.5 AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory a... 25 1.5 AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 25 2.0 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 24 2.7 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 8.2 >AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical protein protein. Length = 127 Score = 25.0 bits (52), Expect = 1.5 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +2 Query: 17 MKLLVVFAMCMLAASAGVVELSADTSNQDLEEKLYNSILTGDY 145 MKL V A +LA +A + + DL+E L + L +Y Sbjct: 1 MKLFVAIAFALLALAAAQEQYTTKYDGIDLDEILKSDRLFNNY 43 >AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory appendage protein SAP-2 protein. Length = 127 Score = 25.0 bits (52), Expect = 1.5 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +2 Query: 17 MKLLVVFAMCMLAASAGVVELSADTSNQDLEEKLYNSILTGDY 145 MKL V A +LA +A + + DL+E L + L +Y Sbjct: 1 MKLFVAIAFALLALAAAQEQYTTKYDGIDLDEILKSDRLFNNY 43 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 24.6 bits (51), Expect = 2.0 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 209 VVNNLIIDKRRNTMEYCYKLWVG-NGQEIVRKYFPL 313 ++N I+ + RN+ME+C G G +VR+ P+ Sbjct: 85 LLNRKILQRLRNSMEHCMAGSGGLGGGAVVREALPI 120 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 24.2 bits (50), Expect = 2.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 234 LSMIRLLTTFWMMEPLPWLSYS 169 L+++ +LT +W M LP+L S Sbjct: 97 LTLVEILTKYWPMGRLPFLCKS 118 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 257 CYKLWVGNGQEIVRKY 304 C LW+GN + + KY Sbjct: 775 CASLWLGNAIQTLNKY 790 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,687 Number of Sequences: 2352 Number of extensions: 10723 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -