BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301H11f (366 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 3.4 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 6.0 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 6.0 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 20 8.0 DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. 20 8.0 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 3.4 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -1 Query: 273 ENLVFIIDCLSEERDQLRFSPLHAQSQRDRRQLLYRVQTKLYIL 142 EN++ I+D L +E +QL A + +D + Y + K+Y L Sbjct: 373 ENVLAIVDRLMDETNQLTLQET-ADAFKDLQDKYYE-EYKMYEL 414 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 20.6 bits (41), Expect = 6.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 320 PPTKLMKLP 294 P TKLMKLP Sbjct: 150 PDTKLMKLP 158 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 20.6 bits (41), Expect = 6.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 320 PPTKLMKLP 294 P TKLMKLP Sbjct: 150 PDTKLMKLP 158 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 20.2 bits (40), Expect = 8.0 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 19 LSAYTLN*NQDKAQ*IKMAASDSGTDESLYPIAV 120 LS++TLN N DK + + D +Y +A+ Sbjct: 224 LSSHTLNHNSDKMSDQQENLTLKEVDNKVYGMAL 257 >DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. Length = 135 Score = 20.2 bits (40), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 51 QSSIDKNGSERLRDG*IIVSD 113 ++SID+ + RDG I V D Sbjct: 36 ETSIDQQKEDDFRDGNIDVED 56 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,434 Number of Sequences: 438 Number of extensions: 1392 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8680350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -