BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301H09f (386 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 0.97 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 3.9 DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. 22 9.0 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 22 9.0 AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 prot... 22 9.0 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 22 9.0 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.0 bits (52), Expect = 0.97 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 19 KHLRTPRHSPT*PL*GSTI-FEYPPV 93 KHL+TP SPT P G + F+ P V Sbjct: 102 KHLQTPEGSPTGPPTGIAVRFQTPDV 127 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.0 bits (47), Expect = 3.9 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 207 CFGIITYFHIYYHSYS 160 CF ++T+F YY++ S Sbjct: 569 CFVVLTFFIYYYYAVS 584 >DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. Length = 391 Score = 21.8 bits (44), Expect = 9.0 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +1 Query: 121 CYGDSFNCLVTVITVRMVINV 183 CY + NC V+ VR+ +++ Sbjct: 41 CYDEKCNCAVSPYHVRLALSM 61 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 21.8 bits (44), Expect = 9.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 5 HEGKVSIYGRQDIVQHDLYRVRRFLNIHLCL 97 HEGK+S + + +LYR+ R + C+ Sbjct: 1709 HEGKLSHLRSKQVSNLNLYRLGRRKRLGDCM 1739 >AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 protein. Length = 128 Score = 21.8 bits (44), Expect = 9.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 41 IVQHDLYRVRRFLNIH 88 ++ +D+Y V FLN H Sbjct: 24 VIHNDIYDVTEFLNEH 39 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 21.8 bits (44), Expect = 9.0 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -3 Query: 192 TYFHIYYHSYSNDCY*TVKTIAITD 118 +Y H Y H+ S DC V + T+ Sbjct: 895 SYLHKYRHASSPDCPACVSIVESTE 919 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 384,088 Number of Sequences: 2352 Number of extensions: 7228 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29929410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -