BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301H09f (386 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC001133-1|AAH01133.1| 526|Homo sapiens asparagine-linked glyco... 29 6.9 AJ224875-1|CAA12176.1| 532|Homo sapiens glucosyltransferase pro... 29 6.9 >BC001133-1|AAH01133.1| 526|Homo sapiens asparagine-linked glycosylation 8 homolog (S. cerevisiae, alpha-1,3-glucosyltra protein. Length = 526 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -2 Query: 253 YYNKLSRYNLQHTIIMFWYHYIFSHLLP-FVQXXXXLNS*NYRHNR 119 YY S + L + W+ YI SH+ F Q +++ NY +R Sbjct: 56 YYEATSEWTLDYPPFFAWFEYILSHVAKYFDQEMLNVHNLNYSSSR 101 >AJ224875-1|CAA12176.1| 532|Homo sapiens glucosyltransferase protein. Length = 532 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -2 Query: 253 YYNKLSRYNLQHTIIMFWYHYIFSHLLP-FVQXXXXLNS*NYRHNR 119 YY S + L + W+ YI SH+ F Q +++ NY +R Sbjct: 62 YYEATSEWTLDYPPFFAWFEYILSHVAKYFDQEMLNVHNLNYSSSR 107 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,378,359 Number of Sequences: 237096 Number of extensions: 890798 Number of successful extensions: 1214 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1214 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2641190740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -