BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301H07f (445 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 5.2 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 20 9.2 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.0 bits (42), Expect = 5.2 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 368 GVRDSNGNELPSVPEMRKKFD 430 G + N + + EMRK+FD Sbjct: 149 GAYNDKSNYVTLIKEMRKEFD 169 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 20.2 bits (40), Expect = 9.2 Identities = 11/47 (23%), Positives = 18/47 (38%) Frame = +2 Query: 263 ARNSAIGTTSERTESRRYKDSSPTSGYTKRNSLTNGVRDSNGNELPS 403 + +G S + P + K NS+T + S G LP+ Sbjct: 8 SNEDTLGARSPGGDHSENMQDEPENLSNKSNSITVPLSISTGQRLPA 54 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,924 Number of Sequences: 336 Number of extensions: 1551 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9985735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -