BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301H06f (334 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 25 0.24 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 3.0 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 20 6.8 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 20 9.1 DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 20 9.1 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 25.0 bits (52), Expect = 0.24 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 159 GRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSP 296 G +L GVV K KM R + + H + N+FE + +H+SP Sbjct: 590 GMVLAGVVGK-KMPRYCL----FGHNVTLANKFESLSEPLRIHVSP 630 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 3.0 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 Query: 11 RFPEQERWHEEEGHAS 58 R P + WH E H S Sbjct: 149 RTPTEASWHSPEAHIS 164 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 20.2 bits (40), Expect = 6.8 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 88 VLKPKPTFLW*RMSFLFMP 32 +LKPKP + ++S L +P Sbjct: 40 ILKPKPLWTGKQISSLIIP 58 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 19.8 bits (39), Expect = 9.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +3 Query: 237 LPKYNRFEKRHRNMSVHLS 293 LP++ R R+ ++HLS Sbjct: 185 LPQFRVLGHRQRHSTIHLS 203 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 19.8 bits (39), Expect = 9.1 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +3 Query: 39 KRKDMRHHKNVGLGFKTPREAIEGTYIDKKC 131 K +M + KN+ + K E I KC Sbjct: 98 KLVEMANRKNISIDVKMLSECINANKSTDKC 128 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,950 Number of Sequences: 438 Number of extensions: 1418 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7466580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -