BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301H04f (459 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 27 0.42 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 3.9 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 3.9 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 3.9 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 3.9 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 22 9.0 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 22 9.0 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 22 9.0 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 26.6 bits (56), Expect = 0.42 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -2 Query: 434 LILPNVCI-LKQPAILYWGHSFSKSLYNNIRPYQQNLYTLCGHKIYQILFLIIKFVTLQP 258 LIL NVC LKQP LY G + S L + + + Y + G + + + I + Sbjct: 175 LILRNVCTSLKQPE-LYEGQNLSNQLLDIFKQCSTDDYAVAGRFVSEAVNEIFTDTETES 233 Query: 257 *TFLILV*IF 228 F I+ IF Sbjct: 234 EGFAIIRGIF 243 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 3.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 299 DIFYDHTVYTGSAGMALYYYTSSLKMNDPSKEL 397 D F H+V GMA+ T L ++ PS EL Sbjct: 275 DSFMAHSVLQVLKGMAMKGKTIILTIHQPSSEL 307 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 3.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 299 DIFYDHTVYTGSAGMALYYYTSSLKMNDPSKEL 397 D F H+V GMA+ T L ++ PS EL Sbjct: 275 DSFMAHSVLQVLKGMAMKGKTIILTIHQPSSEL 307 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.4 bits (48), Expect = 3.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 299 DIFYDHTVYTGSAGMALYYYTSSLKMNDPSKEL 397 D F H+V GMA+ T L ++ PS EL Sbjct: 253 DSFMAHSVLQVLKGMAMKGKTIILTIHQPSSEL 285 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 3.9 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +2 Query: 269 LQTLLSKIESDIFYDHT-----VYTGSAGMALYYYTSSLKMNDPSKE 394 L +K+ SD F T T G LY YT L +N P KE Sbjct: 787 LNKYCAKLPSDTFTKLTPIWRCATTVRKGRKLYQYTIRLPINSPWKE 833 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 22.2 bits (45), Expect = 9.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 185 SAANVLDESGEQISQKFKLKLEKFK 259 S A +DE + QK +L+ E+FK Sbjct: 828 SRARKIDEEERSLRQKQELEREEFK 852 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.2 bits (45), Expect = 9.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 101 LDNNYGDRTINRRQYNRY 48 L N YGD R +NRY Sbjct: 596 LMNKYGDSKSQRNIFNRY 613 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.2 bits (45), Expect = 9.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 101 LDNNYGDRTINRRQYNRY 48 L N YGD R +NRY Sbjct: 596 LMNKYGDSKSQRNIFNRY 613 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 439,373 Number of Sequences: 2352 Number of extensions: 7728 Number of successful extensions: 25 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -