BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301H03f (462 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 2.8 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 22 2.8 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 2.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 2.8 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 3.7 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 3.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 3.7 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 6.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 6.5 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 6.5 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 6.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 6.5 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 8.5 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 8.5 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 340 CCFAILCWCCSN 375 CC CWCC N Sbjct: 11 CC----CWCCDN 18 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 325 WSSKRCRTYWSSKRC 281 W S C YW++K C Sbjct: 98 WGS--CNNYWNTKNC 110 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 2.8 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +1 Query: 340 CCFAILCWCCSNPA 381 CC+ +CW + PA Sbjct: 488 CCWWKICWTITTPA 501 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 2.8 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +1 Query: 340 CCFAILCWCCSNPA 381 CC+ +CW + PA Sbjct: 541 CCWWKICWTITTPA 554 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.8 bits (44), Expect = 3.7 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -3 Query: 88 YCW-NSCDCTRFSSNYKGSSDEYDR 17 + W N DC+ S YK + D++DR Sbjct: 114 WSWANYKDCSGIVSAYKIAIDKFDR 138 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 3.7 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -3 Query: 88 YCW-NSCDCTRFSSNYKGSSDEYDR 17 + W N DC+ S YK + D++DR Sbjct: 114 WSWANYKDCSGIVSAYKIAIDKFDR 138 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 3.7 Identities = 10/46 (21%), Positives = 22/46 (47%) Frame = -2 Query: 449 EVLDHMGSRQRMQQEQGECREPLAGLEQHQHSMAKQHRMPLLEQQE 312 E M ++Q+ QQ+Q + + + + Q +Q + +QQ+ Sbjct: 413 EQQQQMQAQQQHQQQQQQTQHVINAQQPQQQQQQQQQQQQQQQQQQ 458 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 6.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 116 HVGYAQAIPQNIPPYA 163 H+G + PQ IPP A Sbjct: 152 HIGPSTPFPQFIPPNA 167 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 292 SKRCSVGCSYRSSKWSCNRGYGRSE 218 S CS S RSS S +R RSE Sbjct: 18 SNTCSNSQSQRSSGSSISRNSNRSE 42 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -3 Query: 70 DCTRFSSNYKGSSDEYDR 17 DC++ S +K + D++DR Sbjct: 118 DCSKIVSAFKIAIDKFDR 135 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 292 SKRCSVGCSYRSSKWSCNRGYGRSE 218 S CS S RSS S +R RSE Sbjct: 18 SNTCSNSQSQRSSGSSISRNSNRSE 42 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 6.5 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = -2 Query: 419 RMQQEQGECREPLAGLEQHQHSMAKQHRMPLLEQQEVP 306 + QQ+Q + ++P +Q Q + + +QQ+ P Sbjct: 1506 QQQQQQQQQQQPQQQSQQPQQQQPQPQQQQQQQQQQQP 1543 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 20.6 bits (41), Expect = 8.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 70 DCTRFSSNYKGSSDEYDR 17 DC+ S +K + DEY+R Sbjct: 122 DCSGIVSAHKIAIDEYER 139 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 20.6 bits (41), Expect = 8.5 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 382 WQDWSSTSIVWRSSIGCRYWSSKRCRTYWS 293 ++ ++S S VW I C S R YW+ Sbjct: 812 FRKFTSASDVWSMGIVCWEVMSYGERPYWN 841 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,248 Number of Sequences: 438 Number of extensions: 2133 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12312900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -