BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301G12f (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7447| Best HMM Match : CHGN (HMM E-Value=0) 29 2.3 SB_57867| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_28305| Best HMM Match : MMR_HSR1 (HMM E-Value=0.0054) 27 9.2 SB_19205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_7447| Best HMM Match : CHGN (HMM E-Value=0) Length = 918 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 100 YKRSYTFLFIQNTHYFNSYGIGRLC 174 YK Y FLF +N ++ +Y G +C Sbjct: 612 YKEEYNFLFNKNAGFWRTYAFGIVC 636 >SB_57867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 27.9 bits (59), Expect = 5.3 Identities = 24/81 (29%), Positives = 36/81 (44%) Frame = -3 Query: 433 FKDFLSHV*SKTSHGAEKPGGINSRAAYEKGKDIDEGHRTGSAALGGCRGVQRSSRLLVC 254 + D++ S TS+G P G ++ A KGK D G +GV+ R L C Sbjct: 630 YNDWICRTGSTTSNGTG-PTGDHTPAMEGKGKQEDWGDSV-------LKGVEWWLRALKC 681 Query: 253 QCPITINNRVKRLVDFTKSSS 191 + + N + VDFTK + Sbjct: 682 RYWFDLGNHEEYDVDFTKKKT 702 >SB_28305| Best HMM Match : MMR_HSR1 (HMM E-Value=0.0054) Length = 425 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 512 YIGNKNTGLLDHTGTSSSAYC 450 ++ K LL HTG+ +SAYC Sbjct: 144 WVEQKAVSLLQHTGSLNSAYC 164 >SB_19205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 376 GGINSRAAYEKGKDIDEGHRTGSAALGGCRG 284 GG + ++ E G D D+G+R+G + GG G Sbjct: 76 GGDDGNSSGESGGDGDDGNRSGESGGGGDDG 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,906,933 Number of Sequences: 59808 Number of extensions: 344700 Number of successful extensions: 793 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -