BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301G10f (443 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 25 0.43 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 0.56 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 0.98 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 1.3 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 20 9.2 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 24.6 bits (51), Expect = 0.43 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 267 INEYTITSKKQVVLKDDYISVNLLLSTKCYLI 172 IN YTI + ++DY+S+ L+ CY I Sbjct: 120 INLYTINYNFKESERNDYVSLLQLVFVFCYFI 151 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.2 bits (50), Expect = 0.56 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -1 Query: 374 LFALCIVYVGYVHLVLLTKECVFCLEIILTL 282 L +CI Y Y+HL+ +F + ++ L Sbjct: 253 LLLVCIYYFYYMHLLFCCAFIIFTMHLLFLL 283 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.4 bits (48), Expect = 0.98 Identities = 11/42 (26%), Positives = 19/42 (45%) Frame = -1 Query: 353 YVGYVHLVLLTKECVFCLEIILTL*TFVKSMNIQLLQRNKSC 228 Y+ V C E++L L ++N+QL + K+C Sbjct: 525 YLRVFFTVFNVVHCYLASELVLMLKNRFVTLNVQLTKLTKNC 566 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 23.0 bits (47), Expect = 1.3 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = -1 Query: 416 YFAQQKPTVRFLRKLFALCIVY 351 YF+++ +RFLR +FA+C ++ Sbjct: 2 YFSRRD--IRFLRPIFAVCRLF 21 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 20.2 bits (40), Expect = 9.2 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -3 Query: 393 SSIFAKVICTLHSLCRIC 340 S + K+ LH +C IC Sbjct: 100 SGVVYKIGYWLHQICHIC 117 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,857 Number of Sequences: 336 Number of extensions: 1959 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9985735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -