BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301G10f (443 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC070260-1|AAH70260.1| 97|Homo sapiens chromosome 6 open readi... 29 5.5 AL096817-2|CAI18941.2| 97|Homo sapiens chromosome 6 open readi... 29 5.5 AF311339-1|AAK38513.1| 138|Homo sapiens DC18 protein. 29 5.5 BC114953-1|AAI14954.1| 229|Homo sapiens ASB14 protein protein. 29 7.2 AF403032-1|AAL57351.1| 302|Homo sapiens ankyrin repeat domain-c... 29 7.2 >BC070260-1|AAH70260.1| 97|Homo sapiens chromosome 6 open reading frame 162 protein. Length = 97 Score = 29.5 bits (63), Expect = 5.5 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -1 Query: 416 YFAQQKPTVRFLRKLFALCIVYVGYVHLVLLTKECVF 306 + KP + F +LC+ Y+GY+H + K+ ++ Sbjct: 42 FIKPNKPVMAFGLVTLSLCVAYIGYLHAIQENKKDLY 78 >AL096817-2|CAI18941.2| 97|Homo sapiens chromosome 6 open reading frame 162 protein. Length = 97 Score = 29.5 bits (63), Expect = 5.5 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -1 Query: 416 YFAQQKPTVRFLRKLFALCIVYVGYVHLVLLTKECVF 306 + KP + F +LC+ Y+GY+H + K+ ++ Sbjct: 42 FIKPNKPVMAFGLVTLSLCVAYIGYLHAIQENKKDLY 78 >AF311339-1|AAK38513.1| 138|Homo sapiens DC18 protein. Length = 138 Score = 29.5 bits (63), Expect = 5.5 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -1 Query: 416 YFAQQKPTVRFLRKLFALCIVYVGYVHLVLLTKECVF 306 + KP + F +LC+ Y+GY+H + K+ ++ Sbjct: 42 FIKPNKPVMAFGLVTLSLCVAYIGYLHAIQENKKDLY 78 >BC114953-1|AAI14954.1| 229|Homo sapiens ASB14 protein protein. Length = 229 Score = 29.1 bits (62), Expect = 7.2 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = -3 Query: 348 RICTSSSSY*RMCFLFRNNTNIIDFCQINEYTITSKKQVVLKDDYISVNLLLS 190 +I +Y + L R+ N+ FC++N S Q LKD+ + + +LL+ Sbjct: 106 QIALRMGNYELISLLLRHGANVNYFCRVNPLHFPSALQYTLKDE-VMLRMLLN 157 >AF403032-1|AAL57351.1| 302|Homo sapiens ankyrin repeat domain-containing SOCS box protein Asb-14 protein. Length = 302 Score = 29.1 bits (62), Expect = 7.2 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = -3 Query: 348 RICTSSSSY*RMCFLFRNNTNIIDFCQINEYTITSKKQVVLKDDYISVNLLLS 190 +I +Y + L R+ N+ FC++N S Q LKD+ + + +LL+ Sbjct: 106 QIALRMGNYELISLLLRHGANVNYFCRVNPLHFPSALQYTLKDE-VMLRMLLN 157 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,414,143 Number of Sequences: 237096 Number of extensions: 943255 Number of successful extensions: 1285 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1285 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3659526016 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -