BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301G05f (428 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L04288-1|AAA35734.2| 1462|Homo sapiens cyclophilin-related prote... 29 6.7 BX957215-1|CAF29506.1| 1162|Homo sapiens hypothetical protein pr... 29 6.7 AF184110-1|AAD56402.1| 1462|Homo sapiens cyclophilin-related pro... 29 6.7 >L04288-1|AAA35734.2| 1462|Homo sapiens cyclophilin-related protein protein. Length = 1462 Score = 29.1 bits (62), Expect = 6.7 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +1 Query: 112 RHAARSLMYDHYISPTRTETAYEAWQRYMVWYGREYGSHYYCTAMKLSYRNFKS 273 RH RS+ Y H S +R+ T+ + Y R + S + SYR++KS Sbjct: 1326 RHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSYKS 1379 >BX957215-1|CAF29506.1| 1162|Homo sapiens hypothetical protein protein. Length = 1162 Score = 29.1 bits (62), Expect = 6.7 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +1 Query: 112 RHAARSLMYDHYISPTRTETAYEAWQRYMVWYGREYGSHYYCTAMKLSYRNFKS 273 RH RS+ Y H S +R+ T+ + Y R + S + SYR++KS Sbjct: 1026 RHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSYKS 1079 >AF184110-1|AAD56402.1| 1462|Homo sapiens cyclophilin-related protein protein. Length = 1462 Score = 29.1 bits (62), Expect = 6.7 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +1 Query: 112 RHAARSLMYDHYISPTRTETAYEAWQRYMVWYGREYGSHYYCTAMKLSYRNFKS 273 RH RS+ Y H S +R+ T+ + Y R + S + SYR++KS Sbjct: 1326 RHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSYKS 1379 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,964,357 Number of Sequences: 237096 Number of extensions: 1429075 Number of successful extensions: 2573 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2572 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3373625546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -