BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301G04f (316 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 4.0 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 4.0 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 20 7.1 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.6 bits (41), Expect = 4.0 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +2 Query: 206 LYDTVLPEKSVFVNKGR 256 +YD L ++S+ +N+GR Sbjct: 254 MYDAFLIDQSLALNRGR 270 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 20.6 bits (41), Expect = 4.0 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 50 VPPPVLWAQRKEDVFLTFSVETKDPTIKIEKD 145 VPPP + + +F + P IK+E D Sbjct: 20 VPPPFGYYHEEPPLFYEERPDFVAPYIKVEAD 51 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 19.8 bits (39), Expect = 7.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 83 PFVVPIILAVELKFR 39 PF +LA+E KFR Sbjct: 121 PFTTQQLLALEKKFR 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,275 Number of Sequences: 336 Number of extensions: 1519 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5836655 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -