BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301G04f (316 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146757-1|AAO12072.1| 246|Anopheles gambiae odorant-binding pr... 22 6.2 AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding pr... 22 6.2 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 21 8.2 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 21 8.2 AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 21 8.2 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 21 8.2 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 21 8.2 AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long fo... 21 8.2 >AY146757-1|AAO12072.1| 246|Anopheles gambiae odorant-binding protein AgamOBP39 protein. Length = 246 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = +2 Query: 98 TFSVETKDPTIKIEKDSVYFRGEGAPDNRLHEVTIALYDT 217 TF P E + + G +NRLH+ ++Y T Sbjct: 26 TFGARDPPPPALREAQAACVKYLGICENRLHQYNNSVYPT 65 >AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding protein OBPjj83a protein. Length = 285 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = +2 Query: 98 TFSVETKDPTIKIEKDSVYFRGEGAPDNRLHEVTIALYDT 217 TF P E + + G +NRLH+ ++Y T Sbjct: 26 TFGARDPPPPALREAQAACVKYLGICENRLHQYNNSVYPT 65 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 400 YFPNSFSGPQTCPRAHK 416 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = -3 Query: 266 SPHICPYLQKHSFPEEQCRTVLSLPHVVYYP 174 +P + P + S P C H+VY P Sbjct: 78 APGVTPNTEPASKPSPNCPPEYDPDHMVYIP 108 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 287 FFPSVISSPHICPYLQK 237 +FP+ S P CP K Sbjct: 384 YFPNSFSGPQTCPRAHK 400 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = -3 Query: 266 SPHICPYLQKHSFPEEQCRTVLSLPHVVYYP 174 +P + P + S P C H+VY P Sbjct: 78 APGVTPNTEPASKPSPNCPPEYDPDHMVYIP 108 >AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long form protein. Length = 311 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/48 (20%), Positives = 20/48 (41%) Frame = -2 Query: 282 SFRNIISXHLPLFTKTLFSGRTVSYSAIVTSCSLLSGAPSPLKYTESF 139 S + + +LP+ K + R + + + + + P K ESF Sbjct: 127 SCAEVFNAYLPVHNKYIGVSRKIYHGTVDSVAKIYEAKPEIKKQEESF 174 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 341,174 Number of Sequences: 2352 Number of extensions: 6580 Number of successful extensions: 19 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 20748816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -