BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301G02f (472 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 22 9.4 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 22 9.4 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 22.2 bits (45), Expect = 9.4 Identities = 11/41 (26%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 96 NYRVEWQEPIAIPLTEQHTLYSVPL-PGSGSVLAFILNMLR 215 ++ + W EP PLT++++ +V + P G + +L +R Sbjct: 143 DFPLSWSEPAFHPLTDEYSNAAVCIDPADGRLKRNLLCPVR 183 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 22.2 bits (45), Expect = 9.4 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +3 Query: 222 IGVDTVAPVGSDLYWHRIVETFKY 293 +G+ + P SD + + + +T KY Sbjct: 175 VGIKLILPEVSDFFMNAVRDTIKY 198 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 495,845 Number of Sequences: 2352 Number of extensions: 9831 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41245467 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -