BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301G01f (468 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 2.9 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 5.0 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 5.0 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 230 KQLDQVDLECIDIYKKMVAAKQKKRPVTKK 141 K L + E ID Y+ +K+K P T K Sbjct: 251 KMLTPIKSEPIDAYEMHQISKKKLSPATPK 280 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 5.0 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 424 GRNWLNKEYLIQRIYHLSLIQ 362 G+ W N LI +HL++++ Sbjct: 131 GQKWRNHRKLIAPTFHLNVLK 151 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.4 bits (43), Expect = 5.0 Identities = 12/49 (24%), Positives = 20/49 (40%) Frame = -2 Query: 368 NPADDEILAEIKKCQTELTAVRKENCRNLKNLIGLCKQEMIRLNLKKQL 222 NP + ++ L N L +GL ++I +NLK Q+ Sbjct: 31 NPDTKRLYDDLLSNYNRLIRPVMNNTETLTVQLGLKLSQLIEMNLKNQV 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,916 Number of Sequences: 438 Number of extensions: 2163 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12559158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -