BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F11f (431 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55686| Best HMM Match : Ribosomal_S7 (HMM E-Value=0) 206 8e-54 SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14) 28 2.8 SB_38055| Best HMM Match : zf-CW (HMM E-Value=1.9) 27 6.6 SB_41149| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_2940| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.4e-22) 27 8.7 SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_55686| Best HMM Match : Ribosomal_S7 (HMM E-Value=0) Length = 272 Score = 206 bits (502), Expect = 8e-54 Identities = 95/124 (76%), Positives = 109/124 (87%) Frame = +1 Query: 58 VVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKR 237 VV + + A ++P+IKLFG+WS DVQVSD+SL DYI+VKEKY+ YLPH+AGRYA KR Sbjct: 69 VVDDDAAAVVAPEVPDIKLFGKWSTEDVQVSDISLTDYIAVKEKYSTYLPHTAGRYAAKR 128 Query: 238 FRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIIXSG 417 FRKAQCPIVER+TNS+MMHGRNNGKKLM VRI+KH+FEIIHLLTGENPLQVLV AII SG Sbjct: 129 FRKAQCPIVERITNSMMMHGRNNGKKLMTVRIIKHSFEIIHLLTGENPLQVLVNAIINSG 188 Query: 418 PRED 429 PRED Sbjct: 189 PRED 192 Score = 42.3 bits (95), Expect = 2e-04 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = +1 Query: 58 VVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSL 162 VV + + A ++P+IKLFG+WS DVQVSD+SL Sbjct: 6 VVDDDAAAVVAPEVPDIKLFGKWSTEDVQVSDISL 40 >SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14) Length = 556 Score = 28.3 bits (60), Expect = 2.8 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 97 IPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYA 228 IPE L C DV + LQ+++ + +KY YL + A +Y+ Sbjct: 511 IPEEAL--NLECPDVDFRESVLQEFLLLDKKYESYLEYLALKYS 552 >SB_38055| Best HMM Match : zf-CW (HMM E-Value=1.9) Length = 439 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 121 RWSCYDVQVSDMSLQDYISVKEKYAKYLP 207 RWSC Q + +++ Y+ KE ++ LP Sbjct: 59 RWSCVTYQAKNQAVECYLPGKEPGSRVLP 87 >SB_41149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 26.6 bits (56), Expect = 8.7 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 7 PIMAEENWNDDVAEAGSVVVETMSLPQAADIPEIKL--FGRWSCYDVQVSDMSLQ 165 P E+ WNDD E V+ +SLP+ + E+ L + +S +VQ+ Q Sbjct: 210 PHFVEKEWNDDTYE---VMRGMISLPEVIAVGEVGLDFYRNYSKKEVQIEAFEKQ 261 >SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 201 IFCVLLFNGNVVLQRHIRDLH 139 IFC LF+G +L+RH+ H Sbjct: 405 IFCRKLFHGKSLLERHVSKRH 425 >SB_2940| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.4e-22) Length = 416 Score = 26.6 bits (56), Expect = 8.7 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = +1 Query: 4 VPIMAEENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVK 183 +PI+ E NDDVA GS + D P IK + Y + + + +Y K Sbjct: 281 LPIVLGEGINDDVAIPGSYI-------NIKDFPNIKALSEYIKY-LDKNHTAYNEYFQWK 332 Query: 184 EKY 192 KY Sbjct: 333 RKY 335 >SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 26.6 bits (56), Expect = 8.7 Identities = 19/104 (18%), Positives = 38/104 (36%), Gaps = 1/104 (0%) Frame = +1 Query: 10 IMAEENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKE- 186 + E+ W+ ++ G + T P + +L WS V D ++ ++I Sbjct: 624 VRIEDEWSSQISPRGGIPQGTRLAPLLFAVLVNRLADEWSTRLKYVDDATVLEFIPRNSP 683 Query: 187 KYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKL 318 Y + RYA +R + + + + +G KL Sbjct: 684 SYLPIVASGISRYATQRNMRLNPNKCKEMVIDFLHYGEQQKHKL 727 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,129,109 Number of Sequences: 59808 Number of extensions: 290312 Number of successful extensions: 631 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 631 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 822495283 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -