BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F11f (431 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 24 2.0 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 23 3.5 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 24.2 bits (50), Expect = 2.0 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 4/31 (12%) Frame = +1 Query: 28 WNDDVAEAGSVVVETM--SLPQAAD--IPEI 108 W++D AEAG+ V E + ++P+A +PE+ Sbjct: 640 WDNDDAEAGAAVPEAVLDAIPEAMPEAVPEV 670 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.4 bits (48), Expect = 3.5 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 318 DGRTYCQTCV*NYSLVNWRKPSASTRDCHYXLW 416 D +C+ C+ +L+N PSA+ ++ H L+ Sbjct: 10 DCTKFCRFCLSEINLLNVIGPSAAEQESHAELF 42 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 472,341 Number of Sequences: 2352 Number of extensions: 9191 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -