BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F10f (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29128| Best HMM Match : Ank (HMM E-Value=2.9e-19) 29 2.3 SB_24078| Best HMM Match : cNMP_binding (HMM E-Value=1.4e-26) 27 9.2 >SB_29128| Best HMM Match : Ank (HMM E-Value=2.9e-19) Length = 454 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 433 DMDSLDVSFIQKTRFHFDILRNGLMYRLIIE 341 D +L ++ KTR H ++L G+MYRL+ E Sbjct: 348 DDSALMLTLQGKTREHLEMLNTGIMYRLLEE 378 >SB_24078| Best HMM Match : cNMP_binding (HMM E-Value=1.4e-26) Length = 692 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +2 Query: 326 HFYDILNNQP----VHQPISQNIKVKSCFLYERY 415 HFYDILN P ++ +N+ + LYE+Y Sbjct: 475 HFYDILNQYPNEKVYNEKWKENLSKRDQELYEKY 508 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,079,473 Number of Sequences: 59808 Number of extensions: 223914 Number of successful extensions: 361 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 361 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -